Putative non-Halobacteriaceae Sec homologs of Archaeoglobus fulgidus TATFIND positive proteins




gi|13540925|ref|NP_110613.1| Chloride channel protein [Thermoplasma volcanium] MEKMKKMFNLSRLPYFEKWFIMGLIIGVISGLGALAFYFAIKLFEYLFLTHMVGATIPHPVGEGGSLAFT YYVRRFYLIPVSTALGGLFSGLIVYTFAPEAEGHGTDAAIRAFHNEQGKIRRRIPVVKTIASAITIGSGG SAGREGPTAQISAGLGSLIADLFGLSDADRRIAVAVGIGSGIGTIFKTPIGGTMLGAEILYKRDLETQAI YPSLVANAVGYSIFASVVGFEPIFGYYTASFQVIRIPYYMVLGVISGLFAIFYVKSFYGTVAFFKKLKIS NYYKPIIGGGLTGIIALFFPEIMATGYGWVNLLMNQKLGEIPTFGIPLLLVLILLPFIKVIATSFTVGSG GSGGVYAPGIFIGAALGTVVAIGFHYLTPSIVPTITPFVIIGMISFFGSAGKVPLSVILMVVEMTGSLQL LPGAMIATFIAYIISGKYSIYHNQVDTRRDSPAHFGEYNTPLLLNIKLSDVKCRDISVSDDDDVEHAKTV MIDHGLASIPVVVYGKLIGALYLFDIAEITTGKVREYMRAGITYLRPTSTAEEAWEVMMRNKTTWCPIVY EGKFKGIVTLNDILDAYEADISKIMRVSSEFE

gi|14601091|ref|NP_147617.1| spermidine/putrescine-binding periplasmic protein [Aeropyrum pernix] MLGVKRAILAGVAAGLVIVAVLAPLVAAVLMGAAASASDRTIKVLNYSEYIDYEVLRIFEERYGIKVVYD EYESAEEAWPYLKAGGGGYDVIIIAHSHVRLAIEQGLVRKLDKSMIPNLSNLDPRIASHPADPTQDYAVP YMWGTTGVAYVEGCVEEPPSTWKEFLSKSYLEKYSGKVSLLSEFSEVVEAGMIALGLDPSDRSSWTEENI DRVVELIIELKPYLAGFYGASQYIPGLVNGELCLAQAWNGDALIAADENPEVGYVAPEDGTLFWVDYMVI PRDAHDVEAAHLFINFLLEPEIAAMNVKAVWYAPSIKKELLEPLAEGDEELREVLDNPLVYPPSNAKLIP SPVLDSEMQSLVEDARSRILASQPSNLDSTLVIVVGVVVLVVAAAFLYRLSRGRAGG