TATFIND negative Halobacteriaceae homologs of Archaeoglobus fulgidus TATFIND positive proteins




gi|7649452|emb|CAB89112.1| nitrate reductase subunit 2 [Haloarcula marismortui subsp. marismortui]
MSSDQQDDQGEEDTLVNVADGVDHQVAMVMDLNKCIGCQTCTIACKNLWTEDGGSEYMYWNNVETKPGEG
YPRGWENSGGGWKSGEHKERQPGEIPDEEDYGRAWEFNHEEIMYEGSDEPLRPRDGAEWGPNWDEDQGAG
EYPNSYYFYLPRICNHCTHPSCVEACPRSALYKRQEDGIVLVDQDRCRGYRYCVEGCPYKKVYYNTVSKK
SEKCIFCYPRIEGEGPDGETFAPACAEECPPQLRLVGFLDDEEGPIHKLVNEYEVALPLHPEFRTQPNVY
YIPPFAPGQHTEDGETVDIDRIPRQYLRDLFGDGVDQALDTIERERQRARQGEDSELMELLQDKNPAKQY
RLEVFDDE