TATFIND positive Halobacteriaceae homologs of Archaeoglobus fulgidus TATFIND positive proteins




gi|7649451|emb|CAB89111.1| nitrate reductase subunit 1 [Haloarcula marismortui subsp. marismortui]; Hydrophobicity: -0.32
MSRNDLTDDEGDSAGISRRDFVRGLGAASLLGATGLSFADDGMDGLEAVDDPIGSYPYRDWEDLYRDEWD
WDSVARSTHSVNCTGSCSWNVYVKDGQVWREEQAGDYPTFDESLPDPNPRGCQKGACYTDYVNADQRVLH
PLRRTGERGEGQWERISWDEALTEIADHVIDEVQAGRYDAISGFTPIPAMSPVSFASGSRLVNLLGGVSH
SFYDWYSDLPPGQPITWGTQTDNAESADWHNADYIIAWGSNINVTRIPDAKYFLDAGYEGAKRVGIFTDY
SQTAIHTDEWLSPHGGSDTALALGMAQTIVDEGLHDEAHLKEQTDMPLLVREDTGKFLRASEVGLAEDAD
DPEKVFVMVDADGTLRRAPGSLGERDGQKDYSASIELDFDPQLSVERSVDTDEGSVAVRSVWENLTDELS
QLRRTLFTKRPASARTPTSESHVSSPRPTPRKSSTARASTTGTTTTLANRAIQLLVTLTGNLGDPGTGLD
HYVGQEKIWSFHGWKVLSFPTGNVRGVPTTLWTYFHAGILDNTDPDTAEKIRESIDKGWMPVYPEERDDG
NRPDPSTMFVWRGNYFNQAKGNVALEEQLWPKLDLVVDINFRMDSTAMYSDIVLPAASHYEKYDLSETDM
HTYVHPFTPAVEPLGEAKTDWEIFRLLAEKIQERAQERGVEPIEDRKFDRTIDLTTIYDDYVRDWETGEE
QGLVEDKAAAEFILEHSEETNPEGSDEQITFDDIDEQPQRFLEAGDHWSSDIKDDEAYVPWQDYVHDKNP
WPTFTGRQQYYIDHDWYLELGEELPTHKEGPENTGGDYPLSYNTPHGRWSIHSTWRDDTKMLRLQRGEPV
VYLNPEDAQQRGIEDGDTVEVYNDLGSVEVQAKIYPSSEPGTVRHFFSWEKFQYPDRDNFNTLVPMYMKP
TQLVQYPEDTGEHLHFFPNYWGPTGVNSDVRVDVRPSGGDTE