TATFIND positive proteins of Sulfolobus solfataricus




TATFIND positive Sulfolobus solfataricus protein
Closest non-S. solfataricus homolog / E value
gi|13814809|gb|AAK41791.1| Molybdopterin oxidoreductase, molybdopterin binding subunit [Sulfolobus solfataricus] / Hydrophobicity: 2.23
MNYDSNIMVENKGLRLNRRDFLKASAAAGLVMGLGYFASKYNFNIFVTRDAVNDEELQPGWQYSYVPSIC
gi|11499961|ref|NP_071207.1| molybdopterin oxidoreductase, ... 271 2e-71
gi|13815946|gb|AAK42755.1| Conserved hypothetical protein [Sulfolobus solfataricus] / Hydrophobicity: 0.46
MMLITERRSPFYPNIQNVPPSVIRKLVKNKAITLIDVRQPWEYEDHHIPGSILLPLDYFKELFPLVLSKN
NONE
gi|13816141|gb|AAK42908.1| Oxydoreductase, putative [Sulfolobus solfataricus] / Hydrophobicity: 4.01
MLKLSRRDFLKISGATAVATAFILGGNSVAKRIFDSVSETNYTLNYPSDEIVYTNCFQCLGRCAIEVVRT
gi|7514761|pir||E70406 DMSO reductase chain A - Aquifex aeo... 191 5e-47
gi|13816354|gb|AAK43076.1| Quinol oxidase-2, rieske iron-sulfur protein-2 (soxF) [Sulfolobus solfataricus] / Hydrophobicity: 7.78
MMNRRTFLRLYLVVGAAVAIAPLIKPLADYVGYFYNEIGTMSKQYLVANNTDGLSGFPKYRIANIKDIQQ
gi|1361934|pir||S56156 Rieske iron-sulfur protein soxF - Su... 424 e-118